Ubiquilin 3 Antikörper (N-Term)

Produktnummer ABIN631218

Produktdetails anti-Ubiquilin 3 Antikörper

Target: Ubiquilin 3 (UBQLN3)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Ubiquilin 3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Ubiquilin 3 antibody was raised against the N terminal of UBQLN3

Aufreinigung: Affinity purified

Immunogen: Ubiquilin 3 antibody was raised using the N terminal of UBQLN3 corresponding to a region with amino acids LMRQHVSVPEFVTQLIDDPFIPGLLSNTGLVRQLVLDNPHMQQLIQHNPE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Ubiquilin 3 Blocking Peptide, catalog no. 33R-5210, is also available for use as a blocking control in assays to test for specificity of this Ubiquilin 3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBQLN3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Ubiquilin 3

Target: Ubiquilin 3 (UBQLN3)

Andere Bezeichnung: Ubiquilin 3 (UBQLN3 Produkte)

Hintergrund: UBQLN3 is an ubiquitin-like protein (ubiquilin) that shares high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation.

Molekulargewicht: 72 kDa (MW of target protein)