PIAS2 Antikörper (N-Term)
-
- Target Alle PIAS2 Antikörper anzeigen
- PIAS2 (Protein Inhibitor of Activated STAT, 2 (PIAS2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PIAS2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PIAS2 antibody was raised against the N terminal of PIAS2
- Aufreinigung
- Affinity purified
- Immunogen
- PIAS2 antibody was raised using the N terminal of PIAS2 corresponding to a region with amino acids RELYRRRYPRTLEGLSDLSTIKSSVFSLDGGSSPVEPDLAVAGIHSLPST
- Top Product
- Discover our top product PIAS2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PIAS2 Blocking Peptide, catalog no. 33R-7881, is also available for use as a blocking control in assays to test for specificity of this PIAS2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIAS2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PIAS2 (Protein Inhibitor of Activated STAT, 2 (PIAS2))
- Andere Bezeichnung
- PIAS2 (PIAS2 Produkte)
- Synonyme
- MGC83751 antikoerper, piasx antikoerper, wu:fi05f09 antikoerper, PIAS2 antikoerper, 6330408K17Rik antikoerper, AI462206 antikoerper, ARIP3 antikoerper, AU018068 antikoerper, Dib antikoerper, Miz1 antikoerper, PIASxalpha antikoerper, PIASxb antikoerper, PIASxbeta antikoerper, SIZ2 antikoerper, DIP antikoerper, MIZ antikoerper, MIZ1 antikoerper, PIASX antikoerper, PIASX-ALPHA antikoerper, PIASX-BETA antikoerper, ZMIZ4 antikoerper, protein inhibitor of activated STAT 2 L homeolog antikoerper, protein inhibitor of activated STAT 2 antikoerper, protein inhibitor of activated STAT, 2 antikoerper, pias2.L antikoerper, PIAS2 antikoerper, pias2 antikoerper, Pias2 antikoerper
- Hintergrund
- Pias2 functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. It plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53 pathway and the steroid hormone signaling pathway.
- Molekulargewicht
- 63 kDa (MW of target protein)
- Pathways
- JAK-STAT Signalweg, Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling
-