TJAP1 Antikörper

Produktnummer ABIN631222

Produktdetails anti-TJAP1 Antikörper

Target: TJAP1 (Tight Junction Associated Protein 1 (Peripheral) (TJAP1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TJAP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: TJAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTSAAPAKKPYRKAPPEHRELRLEIPGSRLEQEEPLTDAERMKLLQEENE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TJAP1 Blocking Peptide, catalog no. 33R-6560, is also available for use as a blocking control in assays to test for specificity of this TJAP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TJAP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TJAP1

Target: TJAP1 (Tight Junction Associated Protein 1 (Peripheral) (TJAP1))

Andere Bezeichnung: TJAP1 (TJAP1 Produkte)

Synonyme: 0610041D19Rik antikoerper, AI415281 antikoerper, AW121008 antikoerper, Pilt antikoerper, Tjp4 antikoerper, TJP4 antikoerper, PILT antikoerper, tight junction associated protein 1 antikoerper, Tjap1 antikoerper, TJAP1 antikoerper

Hintergrund: TJAP1 interacts with DLG1. The exact function of TJAP1 remains unknown.

Molekulargewicht: 15 kDa (MW of target protein)