RAPSN Antikörper (N-Term)
-
- Target Alle RAPSN Antikörper anzeigen
- RAPSN (Receptor-Associated Protein of The Synapse (RAPSN))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RAPSN Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RAPSN antibody was raised against the N terminal of RAPSN
- Aufreinigung
- Affinity purified
- Immunogen
- RAPSN antibody was raised using the N terminal of RAPSN corresponding to a region with amino acids MGQDQTKQQIEKGLQLYQSNQTEKALQVWTKVLEKSSDLMGRFRVLGCLV
- Top Product
- Discover our top product RAPSN Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RAPSN Blocking Peptide, catalog no. 33R-6061, is also available for use as a blocking control in assays to test for specificity of this RAPSN antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAPSN antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAPSN (Receptor-Associated Protein of The Synapse (RAPSN))
- Andere Bezeichnung
- RAPSN (RAPSN Produkte)
- Hintergrund
- RAPSN belongs to a family of proteins that are receptor associated proteins of the synapse. It contains a conserved cAMP-dependent protein kinase phosphorylation site. It is believed to play some role in anchoring or stabilizing the nicotinic acetylcholine receptor at synaptic sites. It may link the receptor to the underlying postsynaptic cytoskeleton, possibly by direct association with actin or spectrin.
- Molekulargewicht
- 39 kDa (MW of target protein)
-