UBR2 Antikörper (C-Term)

Produktnummer ABIN631224

Produktdetails anti-UBR2 Antikörper

Target: UBR2 (Ubiquitin Protein Ligase E3 Component N-Recognin 2 (UBR2))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBR2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: UBR2 antibody was raised against the C terminal of UBR2

Aufreinigung: Affinity purified

Immunogen: UBR2 antibody was raised using the C terminal of UBR2 corresponding to a region with amino acids QGLRRGNPLHLCKERFKKIQKLWHQHSVTEEIGHAQEANQTLVGIDWQHL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UBR2 Blocking Peptide, catalog no. 33R-7566, is also available for use as a blocking control in assays to test for specificity of this UBR2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBR2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UBR2

Target: UBR2 (Ubiquitin Protein Ligase E3 Component N-Recognin 2 (UBR2))

Andere Bezeichnung: UBR2 (UBR2 Produkte)

Synonyme: ba49a4.1 antikoerper, si:ch211-239i4.2 antikoerper, C6orf133 antikoerper, RP3-392M17.3 antikoerper, bA49A4.1 antikoerper, dJ242G1.1 antikoerper, dJ392M17.3 antikoerper, 9930021A08Rik antikoerper, AI462103 antikoerper, AW540746 antikoerper, E130209G04Rik antikoerper, mKIAA0349 antikoerper, ubiquitin protein ligase E3 component n-recognin 2 antikoerper, ubiquitin protein ligase E3 component n-recognin 2 S homeolog antikoerper, UBR2 antikoerper, ubr2 antikoerper, ubr2.S antikoerper, Ubr2 antikoerper

Hintergrund: Proteolysis by the ubiquitin-proteasome system controls the concentration of many regulatory proteins. The selectivity of ubiquitylation is determined by ubiquitin E3 ligases, which recognise the substrate's destabilization signal, or degron. The E3 ligase UBR2 participates in the N-end rule pathway, which targets proteins bearing an N-terminal degron, or N-degron.

Molekulargewicht: 200 kDa (MW of target protein)