ISYNA1 Antikörper (N-Term)

Produktnummer ABIN631226

Produktdetails anti-ISYNA1 Antikörper

Target: ISYNA1 (Inositol-3-Phosphate Synthase 1 (ISYNA1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ISYNA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ISYNA1 antibody was raised against the N terminal of ISYNA1

Aufreinigung: Affinity purified

Immunogen: ISYNA1 antibody was raised using the N terminal of ISYNA1 corresponding to a region with amino acids LQEQLWPHMEALRPRPSVYIPEFIAANQSARADNLIPGSRAQQLEQIRRD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ISYNA1 Blocking Peptide, catalog no. 33R-5306, is also available for use as a blocking control in assays to test for specificity of this ISYNA1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ISYNA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ISYNA1

Target: ISYNA1 (Inositol-3-Phosphate Synthase 1 (ISYNA1))

Andere Bezeichnung: ISYNA1 (ISYNA1 Produkte)

Synonyme: INO1 antikoerper, INOS antikoerper, IPS antikoerper, IPS 1 antikoerper, IPS-1 antikoerper, 1300017C10Rik antikoerper, AU018670 antikoerper, IPS 1-A antikoerper, MI-1-P synthase A antikoerper, MIP synthase A antikoerper, ino1 antikoerper, ino1-a antikoerper, inos antikoerper, ips antikoerper, isyna1 antikoerper, isyna1-a antikoerper, isyna1-b antikoerper, IPS 1-B antikoerper, MI-1-P synthase B antikoerper, MIP synthase B antikoerper, ino1-B antikoerper, inositol-3-phosphate synthase 1 antikoerper, myo-inositol 1-phosphate synthase A1 antikoerper, inositol-3-phosphate synthase 1 S homeolog antikoerper, inositol-3-phosphate synthase 1 L homeolog antikoerper, ISYNA1 antikoerper, Isyna1 antikoerper, sce1804 antikoerper, isyna1.S antikoerper, isyna1.L antikoerper

Hintergrund: Myoinositol, the most common naturally occurring form of inositol, is a component of plasma membrane phospholipids and functions as a cell signaling molecule. ISYNA1 (EC 5.5.1.4), or IPS, is a rate-limiting enzyme that catalyzes the de novo synthesis of myoinositol 1-phosphate from glucose 6-phosphate.

Molekulargewicht: 61 kDa (MW of target protein)