PKC zeta Antikörper (N-Term)
-
- Target Alle PKC zeta (PRKCZ) Antikörper anzeigen
- PKC zeta (PRKCZ) (Protein Kinase C, zeta (PRKCZ))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PKC zeta Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PRKCZ antibody was raised against the N terminal of PRKCZ
- Aufreinigung
- Affinity purified
- Immunogen
- PRKCZ antibody was raised using the N terminal of PRKCZ corresponding to a region with amino acids MDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKP
- Top Product
- Discover our top product PRKCZ Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PRKCZ Blocking Peptide, catalog no. 33R-5876, is also available for use as a blocking control in assays to test for specificity of this PRKCZ antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKCZ antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PKC zeta (PRKCZ) (Protein Kinase C, zeta (PRKCZ))
- Andere Bezeichnung
- PRKCZ (PRKCZ Produkte)
- Synonyme
- TPKC antikoerper, PKCzeta antikoerper, prkcz-A antikoerper, pkc-zeta antikoerper, PRKCZ antikoerper, pkc2 antikoerper, PKC-ZETA antikoerper, PKC2 antikoerper, AI098070 antikoerper, C80388 antikoerper, Pkcz antikoerper, R74924 antikoerper, aPKCzeta antikoerper, zetaPKC antikoerper, 14-3-3-zetaisoform antikoerper, r14-3-3 antikoerper, pkcz antikoerper, si:ch211-150o23.4 antikoerper, protein kinase C zeta L homeolog antikoerper, protein kinase C zeta antikoerper, protein kinase C, zeta antikoerper, prkcz.L antikoerper, PRKCZ antikoerper, prkcz antikoerper, Prkcz antikoerper
- Hintergrund
- Protein kinase C (PKC) zeta is a member of the PKC family of serine/threonine kinases which are involved in a variety of cellular processes such as proliferation, differentiation and secretion. Unlike the classical PKC isoenzymes which are calcium-dependent, PKC zeta exhibits a kinase activity which is independent of calcium and diacylglycerol but not of phosphatidylserine.
- Molekulargewicht
- 45 kDa (MW of target protein)
- Pathways
- NF-kappaB Signalweg, RTK Signalweg, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Membrane, Production of Molecular Mediator of Immune Response, CXCR4-mediated Signaling Events, Thromboxane A2 Receptor Signaling
-