TJP2 Antikörper

Produktnummer ABIN631228

Produktdetails anti-TJP2 Antikörper

Target: TJP2 (Tight Junction Protein 2 (Zona Occludens 2) (TJP2))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TJP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: TJP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TVVPETNKEPRYQEDPPAPQPKAAPRTFLRPSPEDEAIYGPNTKMVRFKK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TJP2 Blocking Peptide, catalog no. 33R-9376, is also available for use as a blocking control in assays to test for specificity of this TJP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TJP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TJP2

Target: TJP2 (Tight Junction Protein 2 (Zona Occludens 2) (TJP2))

Andere Bezeichnung: TJP2 (TJP2 Produkte)

Synonyme: C9DUPq21.11 antikoerper, DFNA51 antikoerper, DUP9q21.11 antikoerper, X104 antikoerper, ZO2 antikoerper, ZO-2 antikoerper, zo2 antikoerper, tjp2 antikoerper, x104 antikoerper, zo-2 antikoerper, wu:fb62b09 antikoerper, zgc:92094 antikoerper, tight junction protein 2 antikoerper, tight junction protein 2 L homeolog antikoerper, tight junction protein 2b (zona occludens 2) antikoerper, TJP2 antikoerper, Tjp2 antikoerper, tjp2.L antikoerper, tjp2b antikoerper

Hintergrund: Tight junction proteins (TJPs) belong to a family of membrane-associated guanylate kinase (MAGUK) homologs that are involved in the organization of epithelial and endothelial intercellular junctions. TJPs bind to the cytoplasmic C termini of junctional transmembrane proteins and link them to the actin cytoskeleton.

Molekulargewicht: 134 kDa (MW of target protein)