MTMR12 Antikörper (Middle Region)
-
- Target Alle MTMR12 Antikörper anzeigen
- MTMR12 (Myotubularin Related Protein 12 (MTMR12))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MTMR12 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MTMR12 antibody was raised against the middle region of MTMR12
- Aufreinigung
- Affinity purified
- Immunogen
- MTMR12 antibody was raised using the middle region of MTMR12 corresponding to a region with amino acids RNSARLSSLFPFALLQRHSSKPVLPTSGWKALGDEDDLAKREDEFVDLGD
- Top Product
- Discover our top product MTMR12 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MTMR12 Blocking Peptide, catalog no. 33R-8086, is also available for use as a blocking control in assays to test for specificity of this MTMR12 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTMR12 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MTMR12 (Myotubularin Related Protein 12 (MTMR12))
- Andere Bezeichnung
- MTMR12 (MTMR12 Produkte)
- Synonyme
- PIP3AP antikoerper, MTMR12 antikoerper, 3-PAP antikoerper, 3Pap antikoerper, 4932703C11 antikoerper, C730015A02Rik antikoerper, Pip3ap antikoerper, mKIAA1682 antikoerper, im:7160376 antikoerper, pip3ap antikoerper, myotubularin related protein 12 antikoerper, MTMR12 antikoerper, mtmr12 antikoerper, Mtmr12 antikoerper
- Hintergrund
- MTMR12 inactives phosphatase that plays a role as an adapter for the phosphatase myotubularin to regulate myotubularin intracellular location.Phosphatidylinositide 3-kinase-derived membrane-anchored phosphatidylinositides, such as phosphatidylinositol 3-phosphate (PtdIns(3)P), regulate diverse cellular processes.
- Molekulargewicht
- 86 kDa (MW of target protein)
-