MPP3 Antikörper
-
- Target Alle MPP3 Antikörper anzeigen
- MPP3 (Membrane Protein, Palmitoylated 3 (MAGUK P55 Subfamily Member 3) (MPP3))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MPP3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- MPP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RDVFSEKSLSYLMKIHEKLRYYERQSPTPVLHSAVALAEDVMEELQAASV
- Top Product
- Discover our top product MPP3 Primärantikörper
-
anti-Membrane Protein, Palmitoylated 3 (MAGUK P55 Subfamily Member 3) (MPP3) (AA 406-434), (C-Term) antibody
MPP3 Reaktivität: Human WB, IF, FACS Wirt: Kaninchen Polyclonal RB33005 unconjugated
anti-Membrane Protein, Palmitoylated 3 (MAGUK P55 Subfamily Member 3) (MPP3) (AA 1-585) antibodyMPP3 Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Membrane Protein, Palmitoylated 3 (MAGUK P55 Subfamily Member 3) (MPP3) (AA 1-585) antibodyMPP3 Reaktivität: Human WB, ELISA, RNAi Wirt: Maus Monoclonal 4D7 unconjugated
anti-Membrane Protein, Palmitoylated 3 (MAGUK P55 Subfamily Member 3) (MPP3) (Center) antibodyMPP3 Reaktivität: Human, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Membrane Protein, Palmitoylated 3 (MAGUK P55 Subfamily Member 3) (MPP3) (AA 301-432) antibodyMPP3 Reaktivität: Human IF, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Membrane Protein, Palmitoylated 3 (MAGUK P55 Subfamily Member 3) (MPP3) (AA 627-802) antibodyMPP3 Reaktivität: Human WB, IHC, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Membrane Protein, Palmitoylated 3 (MAGUK P55 Subfamily Member 3) (MPP3) (AA 385-570) antibodyMPP3 Reaktivität: Ratte WB, IHC, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Membrane Protein, Palmitoylated 3 (MAGUK P55 Subfamily Member 3) (MPP3) (AA 1-585) antibodyMPP3 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Membrane Protein, Palmitoylated 3 (MAGUK P55 Subfamily Member 3) (MPP3) (AA 431-480) antibodyMPP3 Reaktivität: Human, Maus, Schwein, Kaninchen, Rind (Kuh), Huhn WB Wirt: Kaninchen Polyclonal unconjugated
anti-Membrane Protein, Palmitoylated 3 (MAGUK P55 Subfamily Member 3) (MPP3) (AA 35-84) antibodyMPP3 Reaktivität: Human, Maus, Ratte, Schwein, Kaninchen, Rind (Kuh), Hund, Fledermaus, Affe WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MPP3 Blocking Peptide, catalog no. 33R-7863, is also available for use as a blocking control in assays to test for specificity of this MPP3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPP3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MPP3 (Membrane Protein, Palmitoylated 3 (MAGUK P55 Subfamily Member 3) (MPP3))
- Andere Bezeichnung
- MPP3 (MPP3 Produkte)
- Synonyme
- DLG3 antikoerper, 6430514B01 antikoerper, Dlgh3 antikoerper, CSG18 antikoerper, Dlg3 antikoerper, Dusp3 antikoerper, si:ch73-368i2.1 antikoerper, membrane palmitoylated protein 3 antikoerper, membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 3) antikoerper, membrane protein, palmitoylated 3a (MAGUK p55 subfamily member 3) antikoerper, MPP3 antikoerper, Mpp3 antikoerper, mpp3a antikoerper
- Hintergrund
- This gene product is a member of a family of membrane-associated proteins termed MAGUKs (membrane-associated guanylate kinase homologs). MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intracellular junctions
- Molekulargewicht
- 66 kDa (MW of target protein)
-
