PHKG2 Antikörper
-
- Target Alle PHKG2 Antikörper anzeigen
- PHKG2 (phosphorylase Kinase, gamma 2 (Testis) (PHKG2))
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PHKG2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Affinity purified
- Immunogen
- PHKG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEV
- Top Product
- Discover our top product PHKG2 Primärantikörper
-
anti-phosphorylase Kinase, gamma 2 (Testis) (PHKG2) (AA 237-406) antibody
PHKG2 Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-phosphorylase Kinase, gamma 2 (Testis) (PHKG2) (AA 304-334) antibodyPHKG2 Reaktivität: Human, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal RB03701-03702 unconjugated
anti-phosphorylase Kinase, gamma 2 (Testis) (PHKG2) (AA 41-71), (N-Term) antibodyPHKG2 Reaktivität: Human, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal RB3699 unconjugated
anti-phosphorylase Kinase, gamma 2 (Testis) (PHKG2) (AA 1-406) antibodyPHKG2 Reaktivität: Human WB, ELISA, IF Wirt: Maus Monoclonal 2B8 unconjugated
anti-phosphorylase Kinase, gamma 2 (Testis) (PHKG2) (AA 237-406) antibodyPHKG2 Reaktivität: Human WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-phosphorylase Kinase, gamma 2 (Testis) (PHKG2) (AA 1-216) antibodyPHKG2 Reaktivität: Human WB, IF, FACS Wirt: Maus Monoclonal 2A3 unconjugated
anti-phosphorylase Kinase, gamma 2 (Testis) (PHKG2) (AA 1-406) antibodyPHKG2 Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-phosphorylase Kinase, gamma 2 (Testis) (PHKG2) (N-Term) antibodyPHKG2 Reaktivität: Human, Hund, Kaninchen, Rind (Kuh), Schaf, Ziege, Meerschweinchen, Fledermaus, Affe, Schwein WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-phosphorylase Kinase, gamma 2 (Testis) (PHKG2) (N-Term) antibodyPHKG2 Reaktivität: Human, Maus, Ratte, Hund, Kaninchen, Rind (Kuh), Schaf, Ziege, Meerschweinchen, Zebrafisch (Danio rerio) WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-phosphorylase Kinase, gamma 2 (Testis) (PHKG2) (N-Term) antibodyPHKG2 Reaktivität: Human, Maus WB, IHC (p), EIA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PHKG2 Blocking Peptide, catalog no. 33R-2309, is also available for use as a blocking control in assays to test for specificity of this PHKG2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHKG2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PHKG2 (phosphorylase Kinase, gamma 2 (Testis) (PHKG2))
- Andere Bezeichnung
- PHKG2 (PHKG2 Produkte)
- Synonyme
- PHKG2 antikoerper, MGC145608 antikoerper, zgc:55863 antikoerper, GSD9C antikoerper, 1500017I02Rik antikoerper, phosphorylase kinase catalytic subunit gamma 2 antikoerper, phosphorylase kinase, gamma 2 (testis) antikoerper, phosphorylase kinase, gamma 2 (testis) L homeolog antikoerper, PHKG2 antikoerper, phkg2 antikoerper, phkg2.L antikoerper, Phkg2 antikoerper
- Hintergrund
- Mutations in PHKG2 along with PHKA2 and PHKB, all three different genes of phosphorylase kinase (Phk) subunits, can give rise to glycogen storage disease of the liver. The autosomal-recessive, liver-specific variant of Phk deficiency is caused by mutations in the gene encoding the testis/liver isoform of the catalytic gamma subunit, PHKG2.
- Molekulargewicht
- 46 kDa (MW of target protein)
- Pathways
- Cellular Glucan Metabolic Process, Regulation of Carbohydrate Metabolic Process
-
