UMPS Antikörper (C-Term)
-
- Target Alle UMPS Antikörper anzeigen
- UMPS (Uridine Monophosphate Synthetase (UMPS))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UMPS Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- UMPS antibody was raised against the C terminal of UMPS
- Aufreinigung
- Affinity purified
- Immunogen
- UMPS antibody was raised using the C terminal of UMPS corresponding to a region with amino acids VGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDII
- Top Product
- Discover our top product UMPS Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UMPS Blocking Peptide, catalog no. 33R-9552, is also available for use as a blocking control in assays to test for specificity of this UMPS antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UMPS antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UMPS (Uridine Monophosphate Synthetase (UMPS))
- Andere Bezeichnung
- UMPS (UMPS Produkte)
- Synonyme
- zgc:55702 antikoerper, zgc:55723 antikoerper, UMPS antikoerper, OPRT antikoerper, 1700095D23Rik antikoerper, AA408257 antikoerper, AL033308 antikoerper, BB164745 antikoerper, Orotidine 5'-phosphate decarboxylase antikoerper, uridine monophosphate synthetase antikoerper, uridine monophosphate synthetase L homeolog antikoerper, uridine 5'-monophosphate synthase antikoerper, umps-1 antikoerper, umps antikoerper, umps.L antikoerper, UMPS antikoerper, LOC100556619 antikoerper, Umps antikoerper
- Hintergrund
- OPRT (UMPS) is involved in early events of pancreatic and gallbladder carcinogenesis and invasion of hepatocellular carcinomas. Orotate phosphoribosyltransferase is involved in the invasion and metastasis of colorectal carcinoma. Determination of OPRT levels in gastric carcinoma tissue enables to predict the response to S-1-based neoadjuvant/adjuvant chemotherapy.
- Molekulargewicht
- 52 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process
-