MAK Antikörper (C-Term)

Produktnummer ABIN631245

Produktdetails anti-MAK Antikörper

Target: MAK (Male Germ Cell-Associated Kinase (MAK))

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAK Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MAK antibody was raised against the C terminal of MAK

Aufreinigung: Affinity purified

Immunogen: MAK antibody was raised using the C terminal of MAK corresponding to a region with amino acids WNTKTGRGQFSGRTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAK Blocking Peptide, catalog no. 33R-9987, is also available for use as a blocking control in assays to test for specificity of this MAK antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAK

Target: MAK (Male Germ Cell-Associated Kinase (MAK))

Andere Bezeichnung: MAK (MAK Produkte)

Synonyme: RP62 antikoerper, dJ417M14.2 antikoerper, A930010O05Rik antikoerper, Ick antikoerper, fj04c02 antikoerper, wu:fj04c02 antikoerper, zgc:56603 antikoerper, rp62 antikoerper, xmak antikoerper, MGC82717 antikoerper, MGC146434 antikoerper, male germ cell associated kinase antikoerper, male germ cell-associated kinase antikoerper, male germ cell associated kinase L homeolog antikoerper, MAK antikoerper, Mak antikoerper, mak antikoerper, mak.L antikoerper

Hintergrund: MAK is a serine/threonine protein kinase related to kinases involved in cell cycle regulation. It is expressed almost exclusively in the testis, primarily in germ cells. Studies of the mouse and rat homologs have localized the kinase to the chromosomes during meiosis in spermatogenesis, specifically to the synaptonemal complex that exists while homologous chromosomes are paired. There is, however, a study of the mouse homolog that has identified high levels of expression in developing sensory epithelia so its function may be more generalized.

Molekulargewicht: 70 kDa (MW of target protein)