MAK Antikörper (C-Term)
-
- Target Alle MAK Antikörper anzeigen
- MAK (Male Germ Cell-Associated Kinase (MAK))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MAK Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MAK antibody was raised against the C terminal of MAK
- Aufreinigung
- Affinity purified
- Immunogen
- MAK antibody was raised using the C terminal of MAK corresponding to a region with amino acids WNTKTGRGQFSGRTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR
- Top Product
- Discover our top product MAK Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MAK Blocking Peptide, catalog no. 33R-9987, is also available for use as a blocking control in assays to test for specificity of this MAK antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAK antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAK (Male Germ Cell-Associated Kinase (MAK))
- Andere Bezeichnung
- MAK (MAK Produkte)
- Hintergrund
- MAK is a serine/threonine protein kinase related to kinases involved in cell cycle regulation. It is expressed almost exclusively in the testis, primarily in germ cells. Studies of the mouse and rat homologs have localized the kinase to the chromosomes during meiosis in spermatogenesis, specifically to the synaptonemal complex that exists while homologous chromosomes are paired. There is, however, a study of the mouse homolog that has identified high levels of expression in developing sensory epithelia so its function may be more generalized.
- Molekulargewicht
- 70 kDa (MW of target protein)
-