WASF3 Antikörper (N-Term)
-
- Target Alle WASF3 Antikörper anzeigen
- WASF3 (WAS Protein Family, Member 3 (WASF3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser WASF3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- WASF3 antibody was raised against the N terminal of WASF3
- Aufreinigung
- Affinity purified
- Immunogen
- WASF3 antibody was raised using the N terminal of WASF3 corresponding to a region with amino acids NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK
- Top Product
- Discover our top product WASF3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
WASF3 Blocking Peptide, catalog no. 33R-6796, is also available for use as a blocking control in assays to test for specificity of this WASF3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WASF3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- WASF3 (WAS Protein Family, Member 3 (WASF3))
- Andere Bezeichnung
- WASF3 (WASF3 Produkte)
- Synonyme
- wu:fb74d08 antikoerper, wu:fi28e02 antikoerper, zgc:158236 antikoerper, Brush-1 antikoerper, SCAR3 antikoerper, WAVE3 antikoerper, Scar3 antikoerper, Wave3 antikoerper, WAS protein family, member 3b antikoerper, WAS protein family member 3 antikoerper, WAS protein family, member 3 antikoerper, wasf3b antikoerper, WASF3 antikoerper, Wasf3 antikoerper
- Hintergrund
- WASF3 is a member of the Wiskott-Aldrich syndrome protein family. It is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function.
- Molekulargewicht
- 55 kDa (MW of target protein)
- Pathways
- RTK Signalweg
-