RAP1B Antikörper (N-Term)

Produktnummer ABIN631250

Produktdetails anti-RAP1B Antikörper

Target: RAP1B (RAP1B, Member of RAS Oncogene Family (RAP1B))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAP1B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RAP1 B antibody was raised against the N terminal of RAP1

Aufreinigung: Affinity purified

Immunogen: RAP1 B antibody was raised using the N terminal of RAP1 corresponding to a region with amino acids MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAP1B Blocking Peptide, catalog no. 33R-6359, is also available for use as a blocking control in assays to test for specificity of this RAP1B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAP0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAP1B

Target: RAP1B (RAP1B, Member of RAS Oncogene Family (RAP1B))

Andere Bezeichnung: RAP1B (RAP1B Produkte)

Synonyme: K-REV antikoerper, RAL1B antikoerper, k-rev antikoerper, ral1b antikoerper, 2810443E11Rik antikoerper, Rap1b antikoerper, cb1026 antikoerper, cb119 antikoerper, sb:cb119 antikoerper, wu:fb11c04 antikoerper, wu:fb74e09 antikoerper, wu:fk70e05 antikoerper, RAP1B, member of RAS oncogene family antikoerper, RAP1B, member of RAS oncogene family L homeolog antikoerper, RAS related protein 1b antikoerper, ras-related protein Rap-1b-like antikoerper, RAP1B antikoerper, Rap1b antikoerper, rap1b.L antikoerper, Bm1_39445 antikoerper, LOC109067672 antikoerper, rap1b antikoerper

Hintergrund: RAP1B and RAP1A belong to a superfamily of RAS-like small GTP-binding proteins involved in cell signaling.

Molekulargewicht: 21 kDa (MW of target protein)

Pathways: CXCR4-mediated Signaling Events, Signaling of Hepatocyte Growth Factor Receptor