TDO2 Antikörper (N-Term)

Produktnummer ABIN631259

Produktdetails anti-TDO2 Antikörper

Target: TDO2 (Tryptophan 2,3-Dioxygenase (TDO2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TDO2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TDO2 antibody was raised against the N terminal of TDO2

Aufreinigung: Affinity purified

Immunogen: TDO2 antibody was raised using the N terminal of TDO2 corresponding to a region with amino acids LFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TDO2 Blocking Peptide, catalog no. 33R-4940, is also available for use as a blocking control in assays to test for specificity of this TDO2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TDO2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TDO2

Target: TDO2 (Tryptophan 2,3-Dioxygenase (TDO2))

Andere Bezeichnung: TDO2 (TDO2 Produkte)

Synonyme: Tdo2 antikoerper, tdo2l antikoerper, fi30d08 antikoerper, zgc:63488 antikoerper, wu:fi30d08 antikoerper, TDO2 antikoerper, fb62b10 antikoerper, tdo2 antikoerper, wu:fb62b10 antikoerper, zgc:103693 antikoerper, DDBDRAFT_0190495 antikoerper, DDBDRAFT_0231363 antikoerper, DDB_0190495 antikoerper, DDB_0231363 antikoerper, TDO antikoerper, TO antikoerper, TPH2 antikoerper, TRPO antikoerper, AA407491 antikoerper, chky antikoerper, Tdo antikoerper, tryptophan 2,3-dioxygenase b antikoerper, tryptophan 2,3-dioxygenase antikoerper, tryptophan 2,3-dioxygenase a antikoerper, tryptophan 2,3-dioxygenase L homeolog antikoerper, tdo2b antikoerper, tdo2 antikoerper, TDO2 antikoerper, MADE_02822 antikoerper, CtCNB1_3657 antikoerper, tdo2a antikoerper, CNC04830 antikoerper, tdo antikoerper, Mrub_2119 antikoerper, Deipr_2235 antikoerper, Acav_1166 antikoerper, Mesop_4278 antikoerper, Tdo2 antikoerper, tdo2.L antikoerper

Hintergrund: Tryptophan 2,3-dioxygenase (EC 1.13.11.11) plays a role in catalyzing the first and rat-limiting step in the kynurenine pathway, the major pathway of tryptophan metabolism.

Molekulargewicht: 48 kDa (MW of target protein)