TSKS Antikörper (N-Term)

Produktnummer ABIN631260

Produktdetails anti-TSKS Antikörper

Target: TSKS (Testis-Specific serine Kinase Substrate (TSKS))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TSKS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TSKS antibody was raised against the N terminal of TSKS

Aufreinigung: Affinity purified

Immunogen: TSKS antibody was raised using the N terminal of TSKS corresponding to a region with amino acids MASVVVKTIWQSKEIHEAGDTPTGVESCSQLVPEAPRRVTSRAKGIPKKK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TSKS Blocking Peptide, catalog no. 33R-5767, is also available for use as a blocking control in assays to test for specificity of this TSKS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSKS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TSKS

Target: TSKS (Testis-Specific serine Kinase Substrate (TSKS))

Andere Bezeichnung: TSKS (TSKS Produkte)

Synonyme: TSKS antikoerper, STK22S1 antikoerper, TSKS1 antikoerper, TSSKS antikoerper, Stk22s1 antikoerper, Tssks1 antikoerper, testis specific serine kinase substrate antikoerper, testis-specific serine kinase substrate antikoerper, TSKS antikoerper, Tsks antikoerper

Hintergrund: TSKS may play a role in testicular physiology, spermatogenesis or spermiogenesis. Expression of TSKS is highest in the testis and down-regulated in testicular cancer.

Molekulargewicht: 65 kDa (MW of target protein)

Pathways: Toll-Like Receptors Cascades