TEX14 Antikörper (C-Term)
-
- Target Alle TEX14 Antikörper anzeigen
- TEX14 (Testis Expressed 14 (TEX14))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TEX14 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TEX14 antibody was raised against the C terminal of TEX14
- Aufreinigung
- Affinity purified
- Immunogen
- TEX14 antibody was raised using the C terminal of TEX14 corresponding to a region with amino acids ASSDTLVAVEKSYSTSSPIEEDFEGIQGAFAQPQVSGEEKFQMRKILGKN
- Top Product
- Discover our top product TEX14 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TEX14 Blocking Peptide, catalog no. 33R-1529, is also available for use as a blocking control in assays to test for specificity of this TEX14 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TEX14 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TEX14 (Testis Expressed 14 (TEX14))
- Andere Bezeichnung
- TEX14 (TEX14 Produkte)
- Hintergrund
- TEX14 belongs to the protein kinase superfamily. It contains 3 ANK repeats and 1 protein kinase domain. TEX14 is required for spermatogenesis and male fertility. It may be required for normal structure of the intercellular bridge that connects spermatocytes and spermatogonia. It has no protein kinase activity. This gene is similar to a mouse gene that is expressed in the testis.
- Molekulargewicht
- 160 kDa (MW of target protein)
- Pathways
- Maintenance of Protein Location
-