TEX14 Antikörper (C-Term)

Produktnummer ABIN631261

Produktdetails anti-TEX14 Antikörper

Target: TEX14 (Testis Expressed 14 (TEX14))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TEX14 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TEX14 antibody was raised against the C terminal of TEX14

Aufreinigung: Affinity purified

Immunogen: TEX14 antibody was raised using the C terminal of TEX14 corresponding to a region with amino acids ASSDTLVAVEKSYSTSSPIEEDFEGIQGAFAQPQVSGEEKFQMRKILGKN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TEX14 Blocking Peptide, catalog no. 33R-1529, is also available for use as a blocking control in assays to test for specificity of this TEX14 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TEX14 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TEX14

Target: TEX14 (Testis Expressed 14 (TEX14))

Andere Bezeichnung: TEX14 (TEX14 Produkte)

Synonyme: CT113 antikoerper, C85585 antikoerper, testis expressed 14, intercellular bridge forming factor antikoerper, testis expressed gene 14 antikoerper, inactive serine/threonine-protein kinase TEX14 antikoerper, TEX14 antikoerper, Tex14 antikoerper, tex14 antikoerper, LOC100389169 antikoerper

Hintergrund: TEX14 belongs to the protein kinase superfamily. It contains 3 ANK repeats and 1 protein kinase domain. TEX14 is required for spermatogenesis and male fertility. It may be required for normal structure of the intercellular bridge that connects spermatocytes and spermatogonia. It has no protein kinase activity. This gene is similar to a mouse gene that is expressed in the testis.

Molekulargewicht: 160 kDa (MW of target protein)

Pathways: Maintenance of Protein Location