CSNK2A1/CK II alpha Antikörper (Middle Region)
-
- Target Alle CSNK2A1/CK II alpha (CSNK2A1) Antikörper anzeigen
- CSNK2A1/CK II alpha (CSNK2A1) (Casein Kinase 2 alpha 1 (CSNK2A1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, Drosophila melanogaster, C. elegans
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CSNK2A1/CK II alpha Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CK2 alpha 1 antibody was raised against the middle region of CSNK2 A1
- Aufreinigung
- Affinity purified
- Immunogen
- CK2 alpha 1 antibody was raised using the middle region of CSNK2 A1 corresponding to a region with amino acids LGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDP
- Top Product
- Discover our top product CSNK2A1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CK2 alpha 1 Blocking Peptide, catalog no. 33R-4966, is also available for use as a blocking control in assays to test for specificity of this CK2 alpha 1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CSNK2A1/CK II alpha (CSNK2A1) (Casein Kinase 2 alpha 1 (CSNK2A1))
- Abstract
- CSNK2A1 Produkte
- Synonyme
- CK2A2 antikoerper, CSNK2A1 antikoerper, CK2A1 antikoerper, CKII antikoerper, CSNK2A3 antikoerper, CK2A antikoerper, Ck2a antikoerper, BmCK2a antikoerper, wu:fi38e04 antikoerper, wu:fi38h03 antikoerper, csnk2a1 antikoerper, CK-II antikoerper, CK2 antikoerper, Ckiialpha antikoerper, Csnk2a1-rs4 antikoerper, ck2a1 antikoerper, casein kinase 2 alpha 2 antikoerper, casein kinase 2 alpha 1 antikoerper, casein kinase 2 alpha subunit antikoerper, casein kinase 2, alpha 1 polypeptide antikoerper, CK2 protein kinase alpha 2 antikoerper, casein kinase II alpha subunit antikoerper, Casein kinase II alpha subunit antikoerper, casein kinase 2, alpha 1 polypeptide S homeolog antikoerper, CSNK2A2 antikoerper, CSNK2A1 antikoerper, ck2a antikoerper, Ck2a antikoerper, csnk2a1 antikoerper, cka2 antikoerper, Ckiialpha antikoerper, CK2A1 antikoerper, Csnk2a1 antikoerper, csnk2a1.S antikoerper
- Hintergrund
- Casein kinase II is a serine/threonine protein kinase that phosphorylates acidic proteins such as casein. The kinase exists as a tetramer and is composed of an alpha, an alpha-prime, and two beta subunits. The alpha subunits contain the catalytic activity while the beta subunits undergo autophosphorylation. CSNK2A1 represents the alpha subunit.
- Molekulargewicht
- 45 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interaktom
-