RHPN1 Antikörper (Middle Region)

Produktnummer ABIN631270

Produktdetails anti-RHPN1 Antikörper

Target: RHPN1 (Rhophilin, rho GTPase Binding Protein 1 (RHPN1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RHPN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RHPN1 antibody was raised against the middle region of RHPN1

Aufreinigung: Affinity purified

Immunogen: RHPN1 antibody was raised using the middle region of RHPN1 corresponding to a region with amino acids SVLFNIGALHTQIGARQDRSCTEGARRAMEAFQRAAGAFSLLRENFSHAP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RHPN1 Blocking Peptide, catalog no. 33R-8917, is also available for use as a blocking control in assays to test for specificity of this RHPN1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHPN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RHPN1

Target: RHPN1 (Rhophilin, rho GTPase Binding Protein 1 (RHPN1))

Andere Bezeichnung: RHPN1 (RHPN1 Produkte)

Synonyme: si:ch1073-260o7.1 antikoerper, ODF5 antikoerper, RHOPHILIN antikoerper, RHPN antikoerper, BB023497 antikoerper, Grbp antikoerper, Rhophilin antikoerper, mKIAA1929 antikoerper, rhophilin, Rho GTPase binding protein 1 antikoerper, rhophilin Rho GTPase binding protein 1 antikoerper, rhpn1 antikoerper, RHPN1 antikoerper, Rhpn1 antikoerper

Hintergrund: RHPN1 has no enzymatic activity. RHPN1 may serve as a target for Rho, and interact with some cytoskeletal component upon Rho binding or relay a Rho signal to other molecules.

Molekulargewicht: 73 kDa (MW of target protein)