RHPN1 Antikörper (Middle Region)
-
- Target Alle RHPN1 Antikörper anzeigen
- RHPN1 (Rhophilin, rho GTPase Binding Protein 1 (RHPN1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RHPN1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RHPN1 antibody was raised against the middle region of RHPN1
- Aufreinigung
- Affinity purified
- Immunogen
- RHPN1 antibody was raised using the middle region of RHPN1 corresponding to a region with amino acids SAKNRWRLVGPVHLTRGEGGFGLTLRGDSPVLIAAVIPGSQAAAAGLKEG
- Top Product
- Discover our top product RHPN1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RHPN1 Blocking Peptide, catalog no. 33R-8299, is also available for use as a blocking control in assays to test for specificity of this RHPN1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHPN1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RHPN1 (Rhophilin, rho GTPase Binding Protein 1 (RHPN1))
- Andere Bezeichnung
- RHPN1 (RHPN1 Produkte)
- Synonyme
- si:ch1073-260o7.1 antikoerper, ODF5 antikoerper, RHOPHILIN antikoerper, RHPN antikoerper, BB023497 antikoerper, Grbp antikoerper, Rhophilin antikoerper, mKIAA1929 antikoerper, rhophilin, Rho GTPase binding protein 1 antikoerper, rhophilin Rho GTPase binding protein 1 antikoerper, rhpn1 antikoerper, RHPN1 antikoerper, Rhpn1 antikoerper
- Hintergrund
- RHPN1 has no enzymatic activity. RHPN1 may serve as a target for Rho, and interact with some cytoskeletal component upon Rho binding or relay a Rho signal to other molecules.
- Molekulargewicht
- 73 kDa (MW of target protein)
-