DDIT4L Antikörper (Middle Region)

Produktnummer ABIN631272

Produktdetails anti-DDIT4L Antikörper

Target: DDIT4L (DNA-Damage-Inducible Transcript 4-Like (DDIT4L))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDIT4L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DDIT4 L antibody was raised against the middle region of DDIT4

Aufreinigung: Affinity purified

Immunogen: DDIT4 L antibody was raised using the middle region of DDIT4 corresponding to a region with amino acids KLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDIT4L Blocking Peptide, catalog no. 33R-4509, is also available for use as a blocking control in assays to test for specificity of this DDIT4L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDIT0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDIT4L

Target: DDIT4L (DNA-Damage-Inducible Transcript 4-Like (DDIT4L))

Andere Bezeichnung: DDIT4L (DDIT4L Produkte)

Synonyme: 1700037B15Rik antikoerper, 1700108M02Rik antikoerper, REDD2 antikoerper, RTP801L antikoerper, Smhs1 antikoerper, Rtp801L antikoerper, DNA-damage-inducible transcript 4-like antikoerper, DNA damage inducible transcript 4 like antikoerper, Ddit4l antikoerper, DDIT4L antikoerper, ddit4l antikoerper

Hintergrund: DDIT4L inhibits cell growth by regulating the FRAP1 pathway upstream of the TSC1-TSC2 complex and downstream of AKT1.

Molekulargewicht: 22 kDa (MW of target protein)