UNC45A Antikörper
-
- Target Alle UNC45A Antikörper anzeigen
- UNC45A (Unc-45 Homolog A (UNC45A))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UNC45A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- UNC45 A antibody was raised using a synthetic peptide corresponding to a region with amino acids REIASTLMESEMMEILSVLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDG
- Top Product
- Discover our top product UNC45A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UNC45A Blocking Peptide, catalog no. 33R-7872, is also available for use as a blocking control in assays to test for specificity of this UNC45A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC40 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UNC45A (Unc-45 Homolog A (UNC45A))
- Andere Bezeichnung
- UNC45A (UNC45A Produkte)
- Synonyme
- smap1 antikoerper, smap-1 antikoerper, gcunc45 antikoerper, MGC89261 antikoerper, gc-unc45 antikoerper, gcunc-45 antikoerper, iro039700 antikoerper, zgc:112031 antikoerper, GC-UNC45 antikoerper, GCUNC-45 antikoerper, GCUNC45 antikoerper, IRO039700 antikoerper, SMAP-1 antikoerper, SMAP1 antikoerper, AW538196 antikoerper, RGD1305357 antikoerper, unc-45 myosin chaperone A antikoerper, UNC45A antikoerper, unc45a antikoerper, Unc45a antikoerper
- Hintergrund
- UNC45A plays a role in cell proliferation and myoblast fusion, binds progesterone receptor and HSP90, and acts as a regulator of the progesterone receptor chaperoning pathway.
- Molekulargewicht
- 102 kDa (MW of target protein)
-