PRKRIP1 Antikörper
-
- Target Alle PRKRIP1 Antikörper anzeigen
- PRKRIP1 (Prkr Interacting Protein 1 (IL11 Inducible) (PRKRIP1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PRKRIP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PRKRIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASPAASSVRPPRPKKEPQTLVIPKNAAEEQKLKLERLMKNPDKAVPIPE
- Top Product
- Discover our top product PRKRIP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PRKRIP1 Blocking Peptide, catalog no. 33R-5756, is also available for use as a blocking control in assays to test for specificity of this PRKRIP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKRIP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRKRIP1 (Prkr Interacting Protein 1 (IL11 Inducible) (PRKRIP1))
- Andere Bezeichnung
- PRKRIP1 (PRKRIP1 Produkte)
- Synonyme
- C114 antikoerper, KRBOX3 antikoerper, 8430424D23Rik antikoerper, PRKR interacting protein 1 antikoerper, Prkr interacting protein 1 (IL11 inducible) antikoerper, PRKR interacting protein 1 (IL11 inducible) antikoerper, PRKR interacting protein 1) L homeolog antikoerper, PRKRIP1 antikoerper, Prkrip1 antikoerper, prkrip1 antikoerper, prkrip1.L antikoerper
- Hintergrund
- PRKRIP1 binds double-stranded RNA. It inhibits EIF2AK2 kinase activity.
- Molekulargewicht
- 21 kDa (MW of target protein)
-