INMT Antikörper (N-Term)

Produktnummer ABIN631293

Produktdetails anti-INMT Antikörper

Target: INMT (Indolethylamine N-Methyltransferase (INMT))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser INMT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: INMT antibody was raised against the N terminal of INMT

Aufreinigung: Affinity purified

Immunogen: INMT antibody was raised using the N terminal of INMT corresponding to a region with amino acids KGGFTGGDEYQKHFLPRDYLATYYSFDGSPSPEAEMLKFNLECLHKTFGP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

INMT Blocking Peptide, catalog no. 33R-4392, is also available for use as a blocking control in assays to test for specificity of this INMT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INMT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu INMT

Target: INMT (Indolethylamine N-Methyltransferase (INMT))

Andere Bezeichnung: INMT (INMT Produkte)

Synonyme: TEMT antikoerper, Temt antikoerper, MGC68598 antikoerper, INMT antikoerper, nnmt antikoerper, indolethylamine N-methyltransferase antikoerper, indolethylamine N-methyltransferase L homeolog antikoerper, nicotinamide N-methyltransferase antikoerper, INMT antikoerper, Inmt antikoerper, inmt.L antikoerper, LOC489397 antikoerper, inmt antikoerper

Hintergrund: N-methylation of endogenous and xenobiotic compounds is a major method by which they are degraded. This gene encodes an enzyme that N-methylates indoles such as tryptamine.

Molekulargewicht: 29 kDa (MW of target protein)