LCMT2 Antikörper (C-Term)

Produktnummer ABIN631299

Produktdetails anti-LCMT2 Antikörper

Target: LCMT2 (Leucine Carboxyl Methyltransferase 2 (LCMT2))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LCMT2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LCMT2 antibody was raised against the C terminal of LCMT2

Aufreinigung: Affinity purified

Immunogen: LCMT2 antibody was raised using the C terminal of LCMT2 corresponding to a region with amino acids PVLSDWHFLHVGTMAWVRIPVEGEVPEARHSHSACTWQGGALIAGGLGAS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LCMT2 Blocking Peptide, catalog no. 33R-7414, is also available for use as a blocking control in assays to test for specificity of this LCMT2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCMT2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LCMT2

Target: LCMT2 (Leucine Carboxyl Methyltransferase 2 (LCMT2))

Andere Bezeichnung: LCMT2 (LCMT2 Produkte)

Synonyme: si:ch211-194d6.3 antikoerper, wu:fi38a08 antikoerper, PPM2 antikoerper, TYW4 antikoerper, D330024M17 antikoerper, Tyw4 antikoerper, leucine carboxyl methyltransferase 2 antikoerper, hypothetical protein antikoerper, tRNA methyltransferase antikoerper, ANI_1_1244164 antikoerper, AOR_1_496094 antikoerper, PTRG_08920 antikoerper, BDBG_01006 antikoerper, MCYG_03718 antikoerper, MGYG_03321 antikoerper, PGTG_17062 antikoerper, lcmt2 antikoerper, CAALFM_C101150CA antikoerper, LCMT2 antikoerper, Lcmt2 antikoerper

Hintergrund: LCMT2 belongs to the highly variable methyltransferase superfamily. This gene is the inferred homolog of the Saccharomyces cerevisiae carboxymethyltransferase gene PPM2 that is essential for the synthesis of the hypermodified guanosine Wybutosine (yW).

Molekulargewicht: 75 kDa (MW of target protein)