LYRM1 Antikörper (Middle Region)

Produktnummer ABIN631306

Produktdetails anti-LYRM1 Antikörper

Target: LYRM1 (LYR Motif Containing 1 (LYRM1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LYRM1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LYRM1 antibody was raised against the middle region of LYRM1

Aufreinigung: Affinity purified

Immunogen: LYRM1 antibody was raised using the middle region of LYRM1 corresponding to a region with amino acids KEKQYILNEARTLFRKNKNLTDTDLIKQCIDECTARIEIGLHYKIPYPRP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LYRM1 Blocking Peptide, catalog no. 33R-4341, is also available for use as a blocking control in assays to test for specificity of this LYRM1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYRM1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LYRM1

Target: LYRM1 (LYR Motif Containing 1 (LYRM1))

Andere Bezeichnung: LYRM1 (LYRM1 Produkte)

Synonyme: A211C6.1 antikoerper, 1110065L10Rik antikoerper, 2310004B22Rik antikoerper, 4930404J24Rik antikoerper, RGD1563498 antikoerper, wu:fj36g10 antikoerper, zgc:92830 antikoerper, LYR motif containing 1 antikoerper, LYR motif containing 1 S homeolog antikoerper, LYRM1 antikoerper, lyrm1 antikoerper, Lyrm1 antikoerper, lyrm1.S antikoerper

Hintergrund: LYRM1 may promote cell proliferation and inhibition of apoptosis of preadipocytes.

Molekulargewicht: 14 kDa (MW of target protein)