RNF165 Antikörper (Middle Region)

Produktnummer ABIN631316

Produktdetails anti-RNF165 Antikörper

Target: RNF165 (Ring Finger Protein 165 (RNF165))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNF165 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: RNF165 antibody was raised against the middle region of RNF165

Aufreinigung: Affinity purified

Immunogen: RNF165 antibody was raised using the middle region of RNF165 corresponding to a region with amino acids SSTQMVVHEIRNYPYPQLHFLALQGLNPSRHTSAVRESYEELLQLEDRLG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RNF165 Blocking Peptide, catalog no. 33R-8857, is also available for use as a blocking control in assays to test for specificity of this RNF165 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF165 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNF165

Target: RNF165 (Ring Finger Protein 165 (RNF165))

Andere Bezeichnung: RNF165 (RNF165 Produkte)

Synonyme: RNF165 antikoerper, ARKL2 antikoerper, 2900024M11Rik antikoerper, AI427432 antikoerper, G630064H08Rik antikoerper, Gm96 antikoerper, RGD1560744 antikoerper, si:ch73-29c22.3 antikoerper, ring finger protein 165 antikoerper, ring finger protein 165a antikoerper, RNF165 antikoerper, Rnf165 antikoerper, rnf165a antikoerper

Hintergrund: RNF165 is encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.

Molekulargewicht: 38 kDa (MW of target protein)