TRIM55 Antikörper (N-Term)
-
- Target Alle TRIM55 Antikörper anzeigen
- TRIM55 (Tripartite Motif Containing 55 (TRIM55))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TRIM55 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TRIM55 antibody was raised against the N terminal of TRIM55
- Aufreinigung
- Affinity purified
- Immunogen
- TRIM55 antibody was raised using the N terminal of TRIM55 corresponding to a region with amino acids SGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSDQ
- Top Product
- Discover our top product TRIM55 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TRIM55 Blocking Peptide, catalog no. 33R-8464, is also available for use as a blocking control in assays to test for specificity of this TRIM55 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM55 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRIM55 (Tripartite Motif Containing 55 (TRIM55))
- Andere Bezeichnung
- TRIM55 (TRIM55 Produkte)
- Hintergrund
- TRIM55 contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein associates transiently with microtubules, myosin, and titin during muscle sarcomere assembly. It may act as a transient adaptor and plays a regulatory role in the assembly of sarcomeres.
- Molekulargewicht
- 60 kDa (MW of target protein)
-