LIPT1 Antikörper (N-Term)

Produktnummer ABIN631332

Produktdetails anti-LIPT1 Antikörper

Target: LIPT1 (Lipoyltransferase 1 (LIPT1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LIPT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LIPT1 antibody was raised against the N terminal of LIPT1

Aufreinigung: Affinity purified

Immunogen: LIPT1 antibody was raised using the N terminal of LIPT1 corresponding to a region with amino acids NCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LIPT1 Blocking Peptide, catalog no. 33R-6654, is also available for use as a blocking control in assays to test for specificity of this LIPT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIPT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LIPT1

Target: LIPT1 (Lipoyltransferase 1 (LIPT1))

Andere Bezeichnung: LIPT1 (LIPT1 Produkte)

Synonyme: EG623661 antikoerper, lipoyltransferase 1 antikoerper, chromosome 10 C2orf15 homolog antikoerper, LIPT1 antikoerper, MCYG_01144 antikoerper, MGYG_01698 antikoerper, C10H2orf15 antikoerper, Lipt1 antikoerper

Hintergrund: The process of transferring lipoic acid to proteins is a two-step process. The first step is the activation of lipoic acid by lipoate-activating enzyme to form lipoyl-AMP. For the second step, LIPT1 transfers the lipoyl moiety to apoproteins.

Molekulargewicht: 42 kDa (MW of target protein)