METTL2B Antikörper (N-Term)
-
- Target Alle METTL2B Antikörper anzeigen
- METTL2B (Methyltransferase Like 2B (METTL2B))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser METTL2B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- METTL2 B antibody was raised against the N terminal of METTL2
- Aufreinigung
- Affinity purified
- Immunogen
- METTL2 B antibody was raised using the N terminal of METTL2 corresponding to a region with amino acids AGSYPEGAPAILADKRQQFGSRFLSDPARVFHHNAWDNVEWSEEQAAAAE
- Top Product
- Discover our top product METTL2B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
METTL2B Blocking Peptide, catalog no. 33R-1229, is also available for use as a blocking control in assays to test for specificity of this METTL2B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METTL0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- METTL2B (Methyltransferase Like 2B (METTL2B))
- Andere Bezeichnung
- METTL2B (METTL2B Produkte)
- Synonyme
- METL antikoerper, METTL2 antikoerper, METTL2A antikoerper, PSENIP1 antikoerper, Mettl2 antikoerper, methyltransferase like 2B antikoerper, METTL2B antikoerper, Mettl2b antikoerper
- Hintergrund
- METTL2B is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases. This gene is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases. Alternatively spliced variants which encode different protein isoforms have been described, however, not all variants have been fully characterized.
- Molekulargewicht
- 43 kDa (MW of target protein)
-