TRIM49 Antikörper (Middle Region)
-
- Target Alle TRIM49 Antikörper anzeigen
- TRIM49 (Tripartite Motif Containing 49 (TRIM49))
-
Bindungsspezifität
- Middle Region
- Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TRIM49 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TRIM49 antibody was raised against the middle region of TRIM49
- Aufreinigung
- Affinity purified
- Immunogen
- TRIM49 antibody was raised using the middle region of TRIM49 corresponding to a region with amino acids VHITLHHEEANNDIFLYEILRSMCIGCDHQDVPYFTATPRSFLAWGVQTF
- Top Product
- Discover our top product TRIM49 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TRIM49 Blocking Peptide, catalog no. 33R-9578, is also available for use as a blocking control in assays to test for specificity of this TRIM49 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM49 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRIM49 (Tripartite Motif Containing 49 (TRIM49))
- Andere Bezeichnung
- TRIM49 (TRIM49 Produkte)
- Synonyme
- RNF18 antikoerper, TRIM49A antikoerper, TRIM49L2 antikoerper, tripartite motif containing 49 antikoerper, TRIM49 antikoerper
- Hintergrund
- TRIM49 contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein has been found to be preferentially expressed in testis.
- Molekulargewicht
- 53 kDa (MW of target protein)
-