RNF160 Antikörper (N-Term)
-
- Target Alle RNF160 (ZNF294) Antikörper anzeigen
- RNF160 (ZNF294) (Zinc Finger Protein 294 (ZNF294))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RNF160 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ZNF294 antibody was raised against the N terminal of ZNF294
- Aufreinigung
- Affinity purified
- Immunogen
- ZNF294 antibody was raised using the N terminal of ZNF294 corresponding to a region with amino acids MGGKNKQRTKGNLRPSNSGRAAELLAKEQGTVPGFIGFGTSQSDLGYVPA
- Top Product
- Discover our top product ZNF294 Primärantikörper
-
anti-Zinc Finger Protein 294 (ZNF294) (N-Term) antibody
ZNF294 Reaktivität: Human, Maus, Pferd, Kaninchen, Ratte, Rind (Kuh), Hund, Schwein, Zebrafisch (Danio rerio) WB Wirt: Kaninchen Polyclonal unconjugated
anti-Zinc Finger Protein 294 (ZNF294) (AA 462-591) antibodyZNF294 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Zinc Finger Protein 294 (ZNF294) (AA 47-96) antibodyZNF294 Reaktivität: Human, Maus, Pferd, Kaninchen, Ratte, Fledermaus, Affe WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ZNF294 Blocking Peptide, catalog no. 33R-6032, is also available for use as a blocking control in assays to test for specificity of this ZNF294 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZNF294 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNF160 (ZNF294) (Zinc Finger Protein 294 (ZNF294))
- Andere Bezeichnung
- ZNF294 (ZNF294 Produkte)
- Synonyme
- C21orf10 antikoerper, C21orf98 antikoerper, RNF160 antikoerper, ZNF294 antikoerper, Zfp-294 antikoerper, 4930528H02Rik antikoerper, AV266914 antikoerper, C87237 antikoerper, Listerin antikoerper, Rnf160 antikoerper, Zfp294 antikoerper, Znf294 antikoerper, listerin E3 ubiquitin protein ligase 1 antikoerper, LTN1 antikoerper, Ltn1 antikoerper
- Hintergrund
- ZNF294 may function as an E3 ubiquitin-protein ligase. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
- Molekulargewicht
- 200 kDa (MW of target protein)
-
