HERC6 Antikörper (N-Term)

Produktnummer ABIN631343

Produktdetails anti-HERC6 Antikörper

Target: HERC6 (HECT and RLD Domain Containing E3 Ubiquitin Protein Ligase Family Member 6 (HERC6))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HERC6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HERC6 antibody was raised against the N terminal of HERC6

Aufreinigung: Affinity purified

Immunogen: HERC6 antibody was raised using the N terminal of HERC6 corresponding to a region with amino acids LSKDSQVFSWGKNSHGQLGLGKEFPSQASPQRVRSLEGIPLAQVAAGGAH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HERC6 Blocking Peptide, catalog no. 33R-5433, is also available for use as a blocking control in assays to test for specificity of this HERC6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HERC6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HERC6

Target: HERC6 (HECT and RLD Domain Containing E3 Ubiquitin Protein Ligase Family Member 6 (HERC6))

Andere Bezeichnung: HERC6 (HERC6 Produkte)

Synonyme: 1700121D12Rik antikoerper, 2510038N07Rik antikoerper, 4930427L17Rik antikoerper, AI451296 antikoerper, CEB1 antikoerper, Herc5 antikoerper, HECT and RLD domain containing E3 ubiquitin protein ligase family member 6 antikoerper, hect domain and RLD 6 antikoerper, HERC6 antikoerper, Herc6 antikoerper

Hintergrund: HERC6 belongs to the HERC family of ubiquitin ligases, all of which contain a HECT domain and at least 1 RCC1-like domain (RLD). The 350-amino acid HECT domain is predicted to catalyze the formation of a thioester with ubiquitin before transferring it to a substrate, and the RLD is predicted to act as a guanine nucleotide exchange factor for small G proteins.

Molekulargewicht: 115 kDa (MW of target protein)