TRIM67 Antikörper (C-Term)

Produktnummer ABIN631345

Produktdetails anti-TRIM67 Antikörper

Target: TRIM67 (Tripartite Motif Containing 67 (TRIM67))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRIM67 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TRIM67 antibody was raised against the C terminal of TRIM67

Aufreinigung: Affinity purified

Immunogen: TRIM67 antibody was raised using the C terminal of TRIM67 corresponding to a region with amino acids GGVCKGATVGVLLDLNKHTLTFFINGQQQGPTAFSHVDGVFMPALSLNRN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRIM67 Blocking Peptide, catalog no. 33R-3305, is also available for use as a blocking control in assays to test for specificity of this TRIM67 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM67 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRIM67

Target: TRIM67 (Tripartite Motif Containing 67 (TRIM67))

Andere Bezeichnung: TRIM67 (TRIM67 Produkte)

Synonyme: TNL antikoerper, D130049O21Rik antikoerper, RGD1560667 antikoerper, tripartite motif containing 67 antikoerper, tripartite motif-containing 67 antikoerper, TRIM67 antikoerper, Trim67 antikoerper

Hintergrund: The specific function of TRIM67 is not yet known.

Molekulargewicht: 84 kDa (MW of target protein)