TRIM72 Antikörper (N-Term)

Produktnummer ABIN631346

Produktdetails anti-TRIM72 Antikörper

Target: TRIM72 (Tripartite Motif Containing 72 (TRIM72))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRIM72 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TRIM72 antibody was raised against the N terminal of TRIM72

Aufreinigung: Affinity purified

Immunogen: TRIM72 antibody was raised using the N terminal of TRIM72 corresponding to a region with amino acids CASLGSHRGHRLLPAAEAHARLKTQLPQQKLQLQEACMRKEKSVAVLEHQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRIM72 Blocking Peptide, catalog no. 33R-1646, is also available for use as a blocking control in assays to test for specificity of this TRIM72 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM72 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRIM72

Target: TRIM72 (Tripartite Motif Containing 72 (TRIM72))

Andere Bezeichnung: TRIM72 (TRIM72 Produkte)

Hintergrund: TRIM72 belongs to the TRIM/RBCC family. It contains 1 B box-type zinc finger and 1 B30.2/SPRY domain and 1 RING-type zinc finger. The function of TRIM72 remains unknown.

Molekulargewicht: 53 kDa (MW of target protein)