TRIM72 Antikörper (N-Term)
-
- Target Alle TRIM72 Antikörper anzeigen
- TRIM72 (Tripartite Motif Containing 72 (TRIM72))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TRIM72 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TRIM72 antibody was raised against the N terminal of TRIM72
- Aufreinigung
- Affinity purified
- Immunogen
- TRIM72 antibody was raised using the N terminal of TRIM72 corresponding to a region with amino acids CASLGSHRGHRLLPAAEAHARLKTQLPQQKLQLQEACMRKEKSVAVLEHQ
- Top Product
- Discover our top product TRIM72 Primärantikörper
-
anti-Tripartite Motif Containing 72 (TRIM72) (AA 378-477) antibody
TRIM72 Reaktivität: Human WB, ELISA, IP Wirt: Maus Monoclonal 2B8 unconjugated
anti-Tripartite Motif Containing 72 (TRIM72) antibodyTRIM72 Reaktivität: Human, Ratte, Maus WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Tripartite Motif Containing 72 (TRIM72) (AA 299-327), (C-Term) antibodyTRIM72 Reaktivität: Human, Ratte, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal RB29696 unconjugated
anti-Tripartite Motif Containing 72 (TRIM72) (AA 1-269) antibodyTRIM72 Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Tripartite Motif Containing 72 (TRIM72) (AA 1-269) antibodyTRIM72 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Tripartite Motif Containing 72 (TRIM72) (AA 378-477) antibodyTRIM72 Reaktivität: Human ELISA, IP Wirt: Maus Monoclonal 2G1 unconjugated
anti-Tripartite Motif Containing 72 (TRIM72) (Internal Region) antibodyVerified TRIM72 Reaktivität: Human, Maus WB, IHC, ELISA Wirt: Ziege Polyclonal unconjugated
anti-Tripartite Motif Containing 72 (TRIM72) (AA 288-337) antibodyTRIM72 Reaktivität: Human, Ratte, Meerschweinchen, Pferd, Rind (Kuh), Schwein, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-Tripartite Motif Containing 72 (TRIM72) (AA 108-157) antibodyTRIM72 Reaktivität: Human, Ratte, Hund, Meerschweinchen, Pferd, Affe WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Tripartite Motif Containing 72 (TRIM72) (Internal Region) antibody (Biotin)Verified TRIM72 Reaktivität: Maus WB, ELISA Wirt: Ziege Polyclonal Biotin
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TRIM72 Blocking Peptide, catalog no. 33R-1646, is also available for use as a blocking control in assays to test for specificity of this TRIM72 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM72 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRIM72 (Tripartite Motif Containing 72 (TRIM72))
- Andere Bezeichnung
- TRIM72 (TRIM72 Produkte)
- Synonyme
- Trim72 antikoerper, MG53 antikoerper, Mg53 antikoerper, BC067209 antikoerper, RGD1562778 antikoerper, tripartite motif containing 72 antikoerper, tripartite motif containing 72, E3 ubiquitin protein ligase L homeolog antikoerper, tripartite motif-containing 72 antikoerper, TRIM72 antikoerper, trim72.L antikoerper, Trim72 antikoerper
- Hintergrund
- TRIM72 belongs to the TRIM/RBCC family. It contains 1 B box-type zinc finger and 1 B30.2/SPRY domain and 1 RING-type zinc finger. The function of TRIM72 remains unknown.
- Molekulargewicht
- 53 kDa (MW of target protein)
-
