RFPL3 Antikörper (C-Term)

Produktnummer ABIN631355

Produktdetails anti-RFPL3 Antikörper

Target: RFPL3 (Ret Finger Protein-Like 3 (RFPL3))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RFPL3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RFPL3 antibody was raised against the C terminal of RFPL3

Aufreinigung: Affinity purified

Immunogen: RFPL3 antibody was raised using the C terminal of RFPL3 corresponding to a region with amino acids TVPLTFLLVDRKLQRVGIFLDMGMQNVSFFDAESGSHVYTFRSVSAEEPL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RFPL3 Blocking Peptide, catalog no. 33R-9367, is also available for use as a blocking control in assays to test for specificity of this RFPL3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFPL3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RFPL3

Target: RFPL3 (Ret Finger Protein-Like 3 (RFPL3))

Andere Bezeichnung: RFPL3 (RFPL3 Produkte)

Synonyme: RFPL3 antikoerper, ret finger protein like 3 antikoerper, ret finger protein-like 3 antikoerper, RFPL3 antikoerper, LOC738758 antikoerper, LOC100349961 antikoerper, LOC100357271 antikoerper

Hintergrund: The function of RFPL3 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 32 kDa (MW of target protein)