WWP2 Antikörper (Middle Region)

Produktnummer ABIN631357

Produktdetails anti-WWP2 Antikörper

Target: WWP2 (WW Domain Containing E3 Ubiquitin Protein Ligase 2 (WWP2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WWP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: WWP2 antibody was raised against the middle region of WWP2

Aufreinigung: Affinity purified

Immunogen: WWP2 antibody was raised using the middle region of WWP2 corresponding to a region with amino acids EMKYTSEGVRYFVDHNTRTTTFKDPRPGFESGTKQGSPGAYDRSFRWKYH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WWP2 Blocking Peptide, catalog no. 33R-2586, is also available for use as a blocking control in assays to test for specificity of this WWP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WWP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WWP2

Target: WWP2 (WW Domain Containing E3 Ubiquitin Protein Ligase 2 (WWP2))

Andere Bezeichnung: WWP2 (WWP2 Produkte)

Synonyme: aip2 antikoerper, wwp2-like antikoerper, id:ibd1121 antikoerper, wu:fo87e10 antikoerper, zgc:154036 antikoerper, AIP2 antikoerper, WWp2-like antikoerper, 1300010O06Rik antikoerper, AA690238 antikoerper, AW554328 antikoerper, WW domain containing E3 ubiquitin protein ligase 2 antikoerper, WWP2 antikoerper, wwp2 antikoerper, Wwp2 antikoerper

Hintergrund: WWP2 is a member of the NEDD4-like protein family. The family of proteins is known to possess ubiquitin-protein ligase activity. WWP2 contains 4 tandem WW domains. The WW domain is a protein motif consisting of 35 to 40 amino acids and is characterized by 4 conserved aromatic residues. The WW domain may mediate specific protein-protein interactions.

Molekulargewicht: 47 kDa (MW of target protein)

Pathways: Negative Regulation of Transporter Activity