FBXW2 Antikörper (Middle Region)
-
- Target Alle FBXW2 Antikörper anzeigen
- FBXW2 (F-Box and WD Repeat Domain Containing 2 (FBXW2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FBXW2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FBXW2 antibody was raised against the middle region of FBXW2
- Aufreinigung
- Affinity purified
- Immunogen
- FBXW2 antibody was raised using the middle region of FBXW2 corresponding to a region with amino acids SLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSI
- Top Product
- Discover our top product FBXW2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FBXW2 Blocking Peptide, catalog no. 33R-8600, is also available for use as a blocking control in assays to test for specificity of this FBXW2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXW2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FBXW2 (F-Box and WD Repeat Domain Containing 2 (FBXW2))
- Andere Bezeichnung
- FBXW2 (FBXW2 Produkte)
- Synonyme
- FBXW2 antikoerper, md6 antikoerper, fbw2 antikoerper, fwd2 antikoerper, MGC53244 antikoerper, FBW2 antikoerper, Fwd2 antikoerper, Md6 antikoerper, wu:fc72f10 antikoerper, zgc:110365 antikoerper, 2700071L08Rik antikoerper, MD6 antikoerper, F-box and WD repeat domain containing 2 antikoerper, F-box and WD repeat domain containing 2 L homeolog antikoerper, F-box and WD-40 domain protein 2 antikoerper, FBXW2 antikoerper, fbxw2 antikoerper, Fbxw2 antikoerper, fbxw2.L antikoerper
- Hintergrund
- F-box proteins are an expanding family of eukaryotic proteins characterized by an approximately 40 amino acid motif, the F box. Some F-box proteins have been shown to be critical for the ubiquitin-mediated degradation of cellular regulatory proteins. In fact, F-box proteins are one of the four subunits of ubiquitin protein ligases, called SCFs. SCF ligases bring ubiquitin conjugating enzymes to substrates that are specifically recruited by the different F-box proteins.
- Molekulargewicht
- 51 kDa (MW of target protein)
-