F-Box Protein 3 Antikörper (N-Term)
-
- Target Alle F-Box Protein 3 (FBXO3) Antikörper anzeigen
- F-Box Protein 3 (FBXO3)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser F-Box Protein 3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FBXO3 antibody was raised against the N terminal of FBXO3
- Aufreinigung
- Affinity purified
- Immunogen
- FBXO3 antibody was raised using the N terminal of FBXO3 corresponding to a region with amino acids NCCYVSRRLSQLSSHDPLWRRHCKKYWLISEEEKTQKNQCWKSLFIDTYS
- Top Product
- Discover our top product FBXO3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FBXO3 Blocking Peptide, catalog no. 33R-6651, is also available for use as a blocking control in assays to test for specificity of this FBXO3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- F-Box Protein 3 (FBXO3)
- Andere Bezeichnung
- FBXO3 (FBXO3 Produkte)
- Synonyme
- FBA antikoerper, FBX3 antikoerper, 1200002G09Rik antikoerper, 1700026K02Rik antikoerper, AI046358 antikoerper, Fba antikoerper, zgc:112485 antikoerper, DKFZp459H187 antikoerper, F-box protein 3 antikoerper, F-box protein 3 S homeolog antikoerper, FBXO3 antikoerper, Fbxo3 antikoerper, fbxo3.S antikoerper, fbxo3 antikoerper
- Hintergrund
- FBXO3 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXO3 belongs to the Fbxs class.
- Molekulargewicht
- 47 kDa (MW of target protein)
-