FBXW11 Antikörper (N-Term)
-
- Target Alle FBXW11 Antikörper anzeigen
- FBXW11 (F-Box and WD Repeat Domain Containing 11 (FBXW11))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FBXW11 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FBXW11 antibody was raised against the N terminal of FBXW11
- Aufreinigung
- Affinity purified
- Immunogen
- FBXW11 antibody was raised using the N terminal of FBXW11 corresponding to a region with amino acids CLQSMPSVRCLQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESD
- Top Product
- Discover our top product FBXW11 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FBXW11 Blocking Peptide, catalog no. 33R-1744, is also available for use as a blocking control in assays to test for specificity of this FBXW11 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXW11 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FBXW11 (F-Box and WD Repeat Domain Containing 11 (FBXW11))
- Andere Bezeichnung
- FBXW11 (FBXW11 Produkte)
- Synonyme
- BTRC2 antikoerper, BTRCP2 antikoerper, FBW1B antikoerper, FBXW1B antikoerper, Fbw11 antikoerper, Hos antikoerper, 2310065A07Rik antikoerper, AA536858 antikoerper, Fbxw1b antikoerper, HOS antikoerper, btrc2 antikoerper, fbxw11a antikoerper, wu:fa12e12 antikoerper, wu:fb11f03 antikoerper, zgc:63728 antikoerper, fbxw11 antikoerper, fbxw11b antikoerper, fbxw1b antikoerper, wu:fd14d12 antikoerper, wu:fi43f07 antikoerper, F-box and WD repeat domain containing 11 antikoerper, F-box and WD-40 domain protein 11 antikoerper, F-box/WD repeat-containing protein 11 antikoerper, F-box and WD repeat domain containing 11b antikoerper, F-box and WD repeat domain containing 11a antikoerper, FBXW11 antikoerper, Fbxw11 antikoerper, LOC100199403 antikoerper, fbxw11b antikoerper, fbxw11a antikoerper
- Hintergrund
- FBXW11 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbws class and, in addition to an F-box, contains multiple WD40 repeats.
- Molekulargewicht
- 62 kDa (MW of target protein)
-