RNF115 Antikörper (C-Term)

Produktnummer ABIN631370

Produktdetails anti-RNF115 Antikörper

Target: RNF115 (Ring Finger Protein 115 (RNF115))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNF115 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ZNF364 antibody was raised against the C terminal Of Znf364

Aufreinigung: Affinity purified

Immunogen: ZNF364 antibody was raised using the C terminal Of Znf364 corresponding to a region with amino acids PWLELHDTCPVCRKSLNGEDSTRQSQSTEASASNRFSNDSQLHDRWTF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ZNF364 Blocking Peptide, catalog no. 33R-7433, is also available for use as a blocking control in assays to test for specificity of this ZNF364 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZNF364 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNF115

Target: RNF115 (Ring Finger Protein 115 (RNF115))

Andere Bezeichnung: ZNF364 (RNF115 Produkte)

Hintergrund: ZNF364 contains 1 RING-type zinc finger. The exact function of ZNF364 remains unknown.

Molekulargewicht: 34 kDa (MW of target protein)