RNF115 Antikörper (C-Term)
-
- Target Alle RNF115 Antikörper anzeigen
- RNF115 (Ring Finger Protein 115 (RNF115))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RNF115 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ZNF364 antibody was raised against the C terminal Of Znf364
- Aufreinigung
- Affinity purified
- Immunogen
- ZNF364 antibody was raised using the C terminal Of Znf364 corresponding to a region with amino acids PWLELHDTCPVCRKSLNGEDSTRQSQSTEASASNRFSNDSQLHDRWTF
- Top Product
- Discover our top product RNF115 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ZNF364 Blocking Peptide, catalog no. 33R-7433, is also available for use as a blocking control in assays to test for specificity of this ZNF364 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZNF364 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNF115 (Ring Finger Protein 115 (RNF115))
- Andere Bezeichnung
- ZNF364 (RNF115 Produkte)
- Synonyme
- BCA2 antikoerper, ZNF364 antikoerper, 2610028E05Rik antikoerper, AU042696 antikoerper, Zfp364 antikoerper, ring finger protein 115 antikoerper, RNF115 antikoerper, Rnf115 antikoerper
- Hintergrund
- ZNF364 contains 1 RING-type zinc finger. The exact function of ZNF364 remains unknown.
- Molekulargewicht
- 34 kDa (MW of target protein)
-