UBE2S Antikörper (N-Term)
-
- Target Alle UBE2S Antikörper anzeigen
- UBE2S (Ubiquitin-Conjugating Enzyme E2S (UBE2S))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UBE2S Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- UBE2 S antibody was raised against the N terminal of UBE2
- Aufreinigung
- Affinity purified
- Immunogen
- UBE2 S antibody was raised using the N terminal of UBE2 corresponding to a region with amino acids NSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPE
- Top Product
- Discover our top product UBE2S Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UBE2S Blocking Peptide, catalog no. 33R-6884, is also available for use as a blocking control in assays to test for specificity of this UBE2S antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UBE2S (Ubiquitin-Conjugating Enzyme E2S (UBE2S))
- Andere Bezeichnung
- UBE2S (UBE2S Produkte)
- Hintergrund
- UBE2S is a member of the ubiquitin-conjugating enzyme family. It is able to form a thiol ester linkage with ubiquitin in a ubiquitin activating enzyme-dependent manner, a characteristic property of ubiquitin carrier proteins.
- Molekulargewicht
- 24 kDa (MW of target protein)
- Pathways
- Ubiquitin Proteasome Pathway
-