UBE2S Antikörper (N-Term)

Produktnummer ABIN631371

Produktdetails anti-UBE2S Antikörper

Target: UBE2S (Ubiquitin-Conjugating Enzyme E2S (UBE2S))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBE2S Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: UBE2 S antibody was raised against the N terminal of UBE2

Aufreinigung: Affinity purified

Immunogen: UBE2 S antibody was raised using the N terminal of UBE2 corresponding to a region with amino acids NSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UBE2S Blocking Peptide, catalog no. 33R-6884, is also available for use as a blocking control in assays to test for specificity of this UBE2S antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UBE2S

Target: UBE2S (Ubiquitin-Conjugating Enzyme E2S (UBE2S))

Andere Bezeichnung: UBE2S (UBE2S Produkte)

Synonyme: E2-EPF antikoerper, E2EPF antikoerper, EPF5 antikoerper, 0910001J09Rik antikoerper, 6720465F12Rik antikoerper, AA409170 antikoerper, RGD1564746 antikoerper, ube2s antikoerper, UBE2S antikoerper, DDBDRAFT_0188215 antikoerper, DDBDRAFT_0305006 antikoerper, DDB_0188215 antikoerper, DDB_0305006 antikoerper, e2-epf antikoerper, e2epf antikoerper, epf5 antikoerper, ube2s.1 antikoerper, ube2s.1-b antikoerper, ube2s.1-a antikoerper, ubiquitin conjugating enzyme E2 S antikoerper, ubiquitin-conjugating enzyme E2S antikoerper, ubiquitin-conjugating enzyme e2S, putative antikoerper, ubiquitin-conjugating enzyme E2 S antikoerper, ubiquitin conjugating enzyme E2 S S homeolog antikoerper, ubiquitin conjugating enzyme E2 S L homeolog antikoerper, UBE2S antikoerper, Ube2s antikoerper, ube2s antikoerper, ATEG_00324 antikoerper, Smp_180170 antikoerper, MCYG_01532 antikoerper, ube2s.S antikoerper, ube2s.L antikoerper

Hintergrund: UBE2S is a member of the ubiquitin-conjugating enzyme family. It is able to form a thiol ester linkage with ubiquitin in a ubiquitin activating enzyme-dependent manner, a characteristic property of ubiquitin carrier proteins.

Molekulargewicht: 24 kDa (MW of target protein)

Pathways: Ubiquitin Proteasome Pathway