FBXO21 Antikörper (N-Term)
-
- Target Alle FBXO21 Antikörper anzeigen
- FBXO21 (F-Box Protein 21 (FBXO21))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FBXO21 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FBXO21 antibody was raised against the N terminal of FBXO21
- Aufreinigung
- Affinity purified
- Immunogen
- FBXO21 antibody was raised using the N terminal of FBXO21 corresponding to a region with amino acids KEQFRVRWPSLMKHYSPTDYVNWLEEYKVRQKAGLEARKIVASFSKRFFS
- Top Product
- Discover our top product FBXO21 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FBXO21 Blocking Peptide, catalog no. 33R-4350, is also available for use as a blocking control in assays to test for specificity of this FBXO21 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO21 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FBXO21 (F-Box Protein 21 (FBXO21))
- Andere Bezeichnung
- FBXO21 (FBXO21 Produkte)
- Synonyme
- FBX21 antikoerper, 2810425J22Rik antikoerper, AU016673 antikoerper, mKIAA0875 antikoerper, si:ch211-42a13.2 antikoerper, F-box protein 21 antikoerper, FBXO21 antikoerper, Fbxo21 antikoerper, fbxo21 antikoerper
- Hintergrund
- FBXO21 contains 1 F-box domain. It is a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.
- Molekulargewicht
- 71 kDa (MW of target protein)
-