RC3H2 Antikörper (Middle Region)

Produktnummer ABIN631375

Produktdetails anti-RC3H2 Antikörper

Target: RC3H2 (Membrane Associated DNA Binding Protein (RC3H2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RC3H2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RC3 H2 antibody was raised against the middle region of RC3 2

Aufreinigung: Affinity purified

Immunogen: RC3 H2 antibody was raised using the middle region of RC3 2 corresponding to a region with amino acids YSRKGHETPQPQPNSKYKTSMCRDLRQQGGCPRGTNCTFAHSQEELEKYR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RC3H2 Blocking Peptide, catalog no. 33R-10248, is also available for use as a blocking control in assays to test for specificity of this RC3H2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RC0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RC3H2

Target: RC3H2 (Membrane Associated DNA Binding Protein (RC3H2))

Andere Bezeichnung: RC3H2 (RC3H2 Produkte)

Synonyme: Mnab antikoerper, MNAB antikoerper, RNF164 antikoerper, 2900024N03Rik antikoerper, 9430019J22Rik antikoerper, D930043C02Rik antikoerper, Rnf164 antikoerper, ring finger and CCCH-type domains 2 antikoerper, ring finger and CCCH-type zinc finger domains 2 antikoerper, Rc3h2 antikoerper, RC3H2 antikoerper

Hintergrund: The function of RC3H2 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 118 kDa (MW of target protein)