RNF25 Antikörper (Middle Region)

Produktnummer ABIN631379

Produktdetails anti-RNF25 Antikörper

Target: RNF25 (Ring Finger Protein 25 (RNF25))

Bindungsspezifität: Middle Region

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNF25 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: RNF25 antibody was raised against the middle region of RNF25

Aufreinigung: Affinity purified

Immunogen: RNF25 antibody was raised using the middle region of RNF25 corresponding to a region with amino acids CREPLVYDLASLKAAPEPQQPMELYQPSAESLRQQEERKRLYQRQQERGG

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RNF25 Blocking Peptide, catalog no. 33R-1793, is also available for use as a blocking control in assays to test for specificity of this RNF25 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF25 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNF25

Target: RNF25 (Ring Finger Protein 25 (RNF25))

Andere Bezeichnung: RNF25 (RNF25 Produkte)

Synonyme: AO7 antikoerper, 0610009H16Rik antikoerper, ring finger protein 25 antikoerper, RNF25 antikoerper, Rnf25 antikoerper

Hintergrund: RNF25 contains a RING finger motif. The mouse counterpart of this protein has been shown to interact with Rela, the p65 subunit of NF-kappaB (NFKB), and modulate NFKB-mediated transcription activity. The mouse protein also binds ubiquitin-conjugating enzymes (E2s) and is a substrate for E2-dependent ubiquitination.

Molekulargewicht: 51 kDa (MW of target protein)