RNF219 Antikörper (N-Term)

Produktnummer ABIN631380

Produktdetails anti-RNF219 Antikörper

Target: RNF219 (Ring Finger Protein 219 (RNF219))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNF219 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C13 ORF7 antibody was raised against the N terminal Of C13 rf7

Aufreinigung: Affinity purified

Immunogen: C13 ORF7 antibody was raised using the N terminal Of C13 rf7 corresponding to a region with amino acids LVTDNPSKINPETVAEWKKKLRTANEIYEKVKDDVDKLKEANKKLKLENG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C13ORF7 Blocking Peptide, catalog no. 33R-5543, is also available for use as a blocking control in assays to test for specificity of this C13ORF7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNF219

Target: RNF219 (Ring Finger Protein 219 (RNF219))

Andere Bezeichnung: C13ORF7 (RNF219 Produkte)

Synonyme: C13orf7 antikoerper, 2610206B13Rik antikoerper, 2810449K13Rik antikoerper, AI451544 antikoerper, ring finger protein 219 antikoerper, RNF219 antikoerper, Rnf219 antikoerper

Hintergrund: The function of C13orf7 has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 80 kDa (MW of target protein)