FBXO11 Antikörper (Middle Region)

Produktnummer ABIN631382

Produktdetails anti-FBXO11 Antikörper

Target: FBXO11 (F-Box Protein 11 (FBXO11))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FBXO11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FBXO11 antibody was raised against the middle region of FBXO11

Aufreinigung: Affinity purified

Immunogen: FBXO11 antibody was raised using the middle region of FBXO11 corresponding to a region with amino acids HDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FBXO11 Blocking Peptide, catalog no. 33R-3713, is also available for use as a blocking control in assays to test for specificity of this FBXO11 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO11 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FBXO11

Target: FBXO11 (F-Box Protein 11 (FBXO11))

Andere Bezeichnung: FBXO11 (FBXO11 Produkte)

Synonyme: FBX11 antikoerper, PRMT9 antikoerper, UBR6 antikoerper, VIT1 antikoerper, C80048 antikoerper, Jf antikoerper, Vit1 antikoerper, fbxo11 antikoerper, MGC84634 antikoerper, FBXO11 antikoerper, im:6906507 antikoerper, wu:fj83f06 antikoerper, zgc:153171 antikoerper, Fbxo11 antikoerper, DKFZp459P2410 antikoerper, F-box protein 11 antikoerper, F-box protein 11 L homeolog antikoerper, F-box protein 11a antikoerper, F-box only protein 11 antikoerper, hypothetical protein antikoerper, FBXO11 antikoerper, Fbxo11 antikoerper, fbxo11.L antikoerper, fbxo11a antikoerper, CpipJ_CPIJ009919 antikoerper, CpipJ_CPIJ017549 antikoerper, Bm1_52225 antikoerper, LOAG_16571 antikoerper, fbxo11 antikoerper, LOC100115478 antikoerper

Hintergrund: FBXO11 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs.

Molekulargewicht: 94 kDa (MW of target protein)

Pathways: Sensory Perception of Sound