TRIM43 Antikörper (C-Term)

Produktnummer ABIN631387

Produktdetails anti-TRIM43 Antikörper

Target: TRIM43 (Tripartite Motif Containing 43 (TRIM43))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRIM43 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TRIM43 antibody was raised against the C terminal of TRIM43

Aufreinigung: Affinity purified

Immunogen: TRIM43 antibody was raised using the C terminal of TRIM43 corresponding to a region with amino acids NSTMVNSEDIFLLLCLKVDNHFNLLTTSPVFPHYIEKPLGRVGVFLDFES

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRIM43 Blocking Peptide, catalog no. 33R-6890, is also available for use as a blocking control in assays to test for specificity of this TRIM43 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM43 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRIM43

Target: TRIM43 (Tripartite Motif Containing 43 (TRIM43))

Andere Bezeichnung: TRIM43 (TRIM43 Produkte)

Synonyme: TRIM43A antikoerper, tripartite motif containing 43 antikoerper, TRIM43 antikoerper

Hintergrund: TRIM43 belongs to the TRIM/RBCC family. It contains 1 B box-type zinc finger, 1 B30.2/SPRY domain and 1 RING-type zinc finger. The exact function of TRIM43 remains unknown.

Molekulargewicht: 52 kDa (MW of target protein)