TRIM42 Antikörper (C-Term)
-
- Target Alle TRIM42 Antikörper anzeigen
- TRIM42 (Tripartite Motif Containing 42 (TRIM42))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Hund, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TRIM42 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TRIM42 antibody was raised against the C terminal of TRIM42
- Aufreinigung
- Affinity purified
- Immunogen
- TRIM42 antibody was raised using the C terminal of TRIM42 corresponding to a region with amino acids VKTPGPIVIYQTLVYPRAAKVYWTCPAEDVDSFEMEFYEVITSPPNNVQM
- Top Product
- Discover our top product TRIM42 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TRIM42 Blocking Peptide, catalog no. 33R-9638, is also available for use as a blocking control in assays to test for specificity of this TRIM42 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM42 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRIM42 (Tripartite Motif Containing 42 (TRIM42))
- Andere Bezeichnung
- TRIM42 (TRIM42 Produkte)
- Hintergrund
- TRIM42 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, namely a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region.
- Molekulargewicht
- 80 kDa (MW of target protein)
-